PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_28333_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34312 Da    PI: 4.4641
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_28333_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-192174356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Neem_28333_f_1 21 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 74
                    566899***********************************************9 PP

2HD-ZIP_I/II129.61.3e-4120112193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y+alk + ++L++++e+L +e+ke
  Neem_28333_f_1  20 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYEALKLNYDTLQHDNEALLKEIKE 112
                     69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.34E-191578IPR009057Homeodomain-like
PROSITE profilePS5007117.4431676IPR001356Homeobox domain
SMARTSM003896.3E-181980IPR001356Homeobox domain
CDDcd000862.92E-172177No hitNo description
PfamPF000463.3E-162174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.0E-202383IPR009057Homeodomain-like
PRINTSPR000318.4E-64756IPR000047Helix-turn-helix motif
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
PRINTSPR000318.4E-65672IPR000047Helix-turn-helix motif
PfamPF021833.2E-1776117IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MLDGLDEEGC LEESGGHVSE KKRRLSVDQV KALEKNFEVE NKLEPERKVK LAQELGLQPR  60
QVAVWFQNRR ARWKTKQLER DYGVLKANYE ALKLNYDTLQ HDNEALLKEI KELKSKLNEE  120
NTESINPVKE EKVLLVHETD NKTTTLQEES NKLPALVTSS LAAASDPDQE LNYESFNNND  180
NGVLGGISLF PADFKDGSSD SDSSAILNED NSPNAAISSS ATTGIIQNQH HLDLLMSPTS  240
SSLKHSPPPS INCFEFSKPT YQAQFVKMEE HNFFGDEACN FFSDDQAPSL PWYCSDQWTS  300
LETPL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16876RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466270.11e-138PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A067EZZ71e-136A0A067EZZ7_CITSI; Uncharacterized protein
TrEMBLV4SL151e-136V4SL15_9R
STRINGVIT_07s0191g00180.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.14e-56homeobox protein 5